Lineage for d4lkbd1 (4lkb D:1-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961578Species Nostoc sp. [TaxId:103690] [256358] (1 PDB entry)
  8. 2961582Domain d4lkbd1: 4lkb D:1-120 [253609]
    Other proteins in same PDB: d4lkba2, d4lkbb2, d4lkbc2, d4lkbd2, d4lkbf2
    automated match to d1mwwa_
    complexed with gol, so4

Details for d4lkbd1

PDB Entry: 4lkb (more details), 2.16 Å

PDB Description: Crystal structure of a putative 4-Oxalocrotonate Tautomerase from Nostoc sp. PCC 7120
PDB Compounds: (D:) hypothetical protein alr4568/putative 4-Oxalocrotonate Tautomerase

SCOPe Domain Sequences for d4lkbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkbd1 d.80.1.0 (D:1-120) automated matches {Nostoc sp. [TaxId: 103690]}
mvqikvyglaeklnpikaelsnilhtslievlqispekrfhrffpldkldfyypsdrtdn
yliieiimfegrsvetkkqllrdifkkvdekfgisvydieitlfeipkqnwgirgipgde

SCOPe Domain Coordinates for d4lkbd1:

Click to download the PDB-style file with coordinates for d4lkbd1.
(The format of our PDB-style files is described here.)

Timeline for d4lkbd1: