Lineage for d1ckmb1 (1ckm B:239-327)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 800177Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 800202Protein RNA guanylyltransferase (mRNA capping enzyme) [50308] (1 species)
  7. 800203Species Chlorella virus PBCV-1 [TaxId:10506] [50309] (3 PDB entries)
  8. 800205Domain d1ckmb1: 1ckm B:239-327 [25359]
    Other proteins in same PDB: d1ckma2, d1ckmb2
    complexed with gtp

Details for d1ckmb1

PDB Entry: 1ckm (more details), 2.5 Å

PDB Description: structure of two different conformations of mrna capping enzyme in complex with gtp
PDB Compounds: (B:) mRNA capping enzyme

SCOP Domain Sequences for d1ckmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckmb1 b.40.4.6 (B:239-327) RNA guanylyltransferase (mRNA capping enzyme) {Chlorella virus PBCV-1 [TaxId: 10506]}
thhtidfiimsedgtigifdpnlrknvpvgkldgyynkgsivecgfadgtwkyiqgrsdk
nqandrltyektllnieenitidelldlf

SCOP Domain Coordinates for d1ckmb1:

Click to download the PDB-style file with coordinates for d1ckmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ckmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ckmb2