Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [256133] (11 PDB entries) |
Domain d4lh3b1: 4lh3 B:22-563 [253588] Other proteins in same PDB: d4lh3b2 automated match to d4oe5a_ complexed with 1pe, gua |
PDB Entry: 4lh3 (more details), 1.81 Å
SCOPe Domain Sequences for d4lh3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lh3b1 c.82.1.0 (B:22-563) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lrwkhtsslkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiqyq lspfnhahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgprra evlaktmvgqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrgle gfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqf vpadgptfgdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggknfh fvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvgdpa edfgtffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdpqe pimkeeifgpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrnaa gnfyindkstgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwrysy mq
Timeline for d4lh3b1: