SCOPe 2.04: Domain d4lfga_: 4lfg A:

Lineage for d4lfga_ (4lfg A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (27 species)
   not a true protein

7. Species Streptococcus uberis [TaxId:218495] [235348] (2 PDB entries)

8. Domain d4lfga_: 4lfg A: [253575]
   automated match to d4lfea_
   complexed with ipe, mg

Details for d4lfga_

PDB Entry: 4lfg, 1.76 Å

PDB Description: crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, fully liganded complex;

PDB Compounds: (A:) Geranylgeranyl diphosphate synthase

SCOPe Domain Sequences for d4lfga_:

Sequence; same for both SEQRES and ATOM records:

>d4lfga_ a.128.1.0 (A:) automated matches {Streptococcus uberis [TaxId: 218495]}
smdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltes
hfkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgml
aetdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllay
pfwaaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmt
yphllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda

Timeline for d4lfga_:

• d4lfga_ is new in SCOPe 2.04-stable
  
• d4lfga_ appears in SCOPe 2.05
  
• d4lfga_ appears in the current release, SCOPe 2.08, called d4lfga1