Lineage for d1ripa_ (1rip A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 800031Protein Ribosomal protein S17 [50304] (3 species)
  7. 800032Species Bacillus stearothermophilus [TaxId:1422] [50306] (1 PDB entry)
  8. 800033Domain d1ripa_: 1rip A: [25357]
    low-resolution NMR-structure

Details for d1ripa_

PDB Entry: 1rip (more details)

PDB Description: ribosomal protein s17: characterization of the three-dimensional structure by 1h-and 15n-nmr
PDB Compounds: (A:) ribosomal protein s17

SCOP Domain Sequences for d1ripa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ripa_ b.40.4.5 (A:) Ribosomal protein S17 {Bacillus stearothermophilus [TaxId: 1422]}
qrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdivkime
trplsatkrfrlveivekavr

SCOP Domain Coordinates for d1ripa_:

Click to download the PDB-style file with coordinates for d1ripa_.
(The format of our PDB-style files is described here.)

Timeline for d1ripa_: