![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S17 [50304] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50305] (14 PDB entries) |
![]() | Domain d1hnxq_: 1hnx Q: [25356] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_ complexed with mg, pcy, zn |
PDB Entry: 1hnx (more details), 3.4 Å
SCOP Domain Sequences for d1hnxq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
Timeline for d1hnxq_: