Lineage for d1hnxq_ (1hnx Q:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59561Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (10 proteins)
  6. 59611Protein Ribosomal protein S17 [50304] (2 species)
  7. 59614Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries)
  8. 59621Domain d1hnxq_: 1hnx Q: [25356]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxq_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1hnxq_:

Click to download the PDB-style file with coordinates for d1hnxq_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxq_: