SCOP 1.69: Domain d1hnwq_: 1hnw Q:

Lineage for d1hnwq_ (1hnw Q:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S17 [50304] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (14 PDB entries)

8. Domain d1hnwq_: 1hnw Q: [25355]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwq_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwq_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

Timeline for d1hnwq_:

• d1hnwq_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwq_ appears in SCOP 1.67
  
• d1hnwq_ appears in SCOP 1.71
  
• d1hnwq_ appears in the current release, SCOPe 2.08