Lineage for d1hnwq_ (1hnw Q:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110688Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins)
  6. 110751Protein Ribosomal protein S17 [50304] (2 species)
  7. 110754Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries)
  8. 110758Domain d1hnwq_: 1hnw Q: [25355]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwq_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1hnwq_:

Click to download the PDB-style file with coordinates for d1hnwq_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwq_: