Lineage for d4lc0a3 (4lc0 A:313-405)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792476Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1792580Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 1792581Protein automated matches [254425] (14 species)
    not a true protein
  7. 1792646Species Thermus thermophilus [TaxId:274] [256285] (6 PDB entries)
  8. 1792650Domain d4lc0a3: 4lc0 A:313-405 [253547]
    Other proteins in same PDB: d4lc0a1, d4lc0a2
    automated match to d1b23p2
    complexed with gnp, mg, nh4, so4

Details for d4lc0a3

PDB Entry: 4lc0 (more details), 2.22 Å

PDB Description: Identifying ligand binding hot spots in proteins using brominated fragments
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d4lc0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lc0a3 b.44.1.0 (A:313-405) automated matches {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d4lc0a3:

Click to download the PDB-style file with coordinates for d4lc0a3.
(The format of our PDB-style files is described here.)

Timeline for d4lc0a3: