Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [256284] (6 PDB entries) |
Domain d4lbwa2: 4lbw A:213-312 [253537] Other proteins in same PDB: d4lbwa1, d4lbwa3 automated match to d1b23p1 complexed with gnp, mg, nh4, so4 |
PDB Entry: 4lbw (more details), 1.74 Å
SCOPe Domain Sequences for d4lbwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lbwa2 b.43.3.0 (A:213-312) automated matches {Thermus thermophilus [TaxId: 274]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp
Timeline for d4lbwa2: