SCOPe 2.06: Domain d4lbwa1: 4lbw A:3-212

Lineage for d4lbwa1 (4lbw A:3-212)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [256283] (6 PDB entries)

8. Domain d4lbwa1: 4lbw A:3-212 [253536]
   Other proteins in same PDB: d4lbwa2, d4lbwa3
   automated match to d1b23p3
   complexed with gnp, mg, nh4, so4

Details for d4lbwa1

PDB Entry: 4lbw, 1.74 Å

PDB Description: identifying ligand binding hot spots in proteins using brominated fragments

PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d4lbwa1:

Sequence; same for both SEQRES and ATOM records:

>d4lbwa1 c.37.1.8 (A:3-212) automated matches {Thermus thermophilus [TaxId: 274]}
gefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargit
intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
hrnpktrrgenewvdkiwelldaideyipt

Timeline for d4lbwa1:

• d4lbwa1 first appeared in SCOPe 2.04
  
• d4lbwa1 appears in SCOPe 2.05
  
• d4lbwa1 appears in SCOPe 2.07
  
• d4lbwa1 appears in the current release, SCOPe 2.08