Lineage for d1hr0q_ (1hr0 Q:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins) 
Protein Ribosomal protein S17 [50304] (2 species) Species Thermus thermophilus [TaxId:274] [50305] (6 PDB entries) 
Domain d1hr0q_: 1hr0 Q: [25353]
Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
Details for d1hr0q_
PDB Entry: 1hr0 (more details), 3.2 Å
PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
SCOP Domain Sequences for d1hr0q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
SCOP Domain Coordinates for d1hr0q_:
Click to download the PDB-style file with coordinates for d1hr0q_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hr0q_:
- d1hr0q_ appears in SCOP 1.57
- d1hr0q_ appears in the current release, SCOPe 2.08
View in 3D
