Lineage for d1fjfq_ (1fjf Q:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59561Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (10 proteins)
  6. 59611Protein Ribosomal protein S17 [50304] (2 species)
  7. 59614Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries)
  8. 59615Domain d1fjfq_: 1fjf Q: [25351]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfq_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1fjfq_:

Click to download the PDB-style file with coordinates for d1fjfq_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfq_: