SCOPe 2.07: Domain d4l29i1: 4l29 I:1-181

Lineage for d4l29i1 (4l29 I:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)

8. Domain d4l29i1: 4l29 I:1-181 [253488]
   Other proteins in same PDB: d4l29a2, d4l29b1, d4l29b2, d4l29c2, d4l29d1, d4l29d2, d4l29e2, d4l29f1, d4l29f2, d4l29g2, d4l29h1, d4l29h2, d4l29i2, d4l29j1, d4l29j2, d4l29k2, d4l29l1, d4l29l2, d4l29m2, d4l29n1, d4l29n2, d4l29o2, d4l29p1, d4l29p2, d4l29q2, d4l29r1, d4l29r2, d4l29s2, d4l29t1, d4l29t2, d4l29u2, d4l29v1, d4l29v2, d4l29w2, d4l29x1, d4l29x2, d4l29y2, d4l29z1, d4l29z2
   automated match to d1hlaa2
   complexed with cl, gol; mutant

Details for d4l29i1

PDB Entry: 4l29, 3.09 Å

PDB Description: Structure of wtMHC class I with NY-ESO1 double mutant

PDB Compounds: (I:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l29i1:

Sequence; same for both SEQRES and ATOM records:

>d4l29i1 d.19.1.1 (I:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d4l29i1:

• d4l29i1 first appeared in SCOPe 2.04
  
• d4l29i1 appears in SCOPe 2.06
  
• d4l29i1 appears in the current release, SCOPe 2.08