Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (2 PDB entries) |
Domain d4l29i1: 4l29 I:1-181 [253488] Other proteins in same PDB: d4l29a2, d4l29b_, d4l29c2, d4l29d_, d4l29e2, d4l29f_, d4l29g2, d4l29h_, d4l29i2, d4l29j_, d4l29k2, d4l29l_, d4l29m2, d4l29n_, d4l29o2, d4l29p_, d4l29q2, d4l29r_, d4l29s2, d4l29t_, d4l29u2, d4l29v_, d4l29w2, d4l29x_, d4l29y2, d4l29z_ automated match to d1hlaa2 complexed with cl, gol; mutant |
PDB Entry: 4l29 (more details), 3.09 Å
SCOPe Domain Sequences for d4l29i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l29i1 d.19.1.1 (I:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d4l29i1:
View in 3D Domains from other chains: (mouse over for more information) d4l29a1, d4l29a2, d4l29b_, d4l29c1, d4l29c2, d4l29d_, d4l29e1, d4l29e2, d4l29f_, d4l29g1, d4l29g2, d4l29h_, d4l29j_, d4l29k1, d4l29k2, d4l29l_, d4l29m1, d4l29m2, d4l29n_, d4l29o1, d4l29o2, d4l29p_, d4l29q1, d4l29q2, d4l29r_, d4l29s1, d4l29s2, d4l29t_, d4l29u1, d4l29u2, d4l29v_, d4l29w1, d4l29w2, d4l29x_, d4l29y1, d4l29y2, d4l29z_ |