Class b: All beta proteins [48724] (119 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S12 [50302] (1 species) |
Species Thermus thermophilus [TaxId:274] [50303] (14 PDB entries) |
Domain d1hnzl_: 1hnz L: [25348] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ complexed with hyg, mg, zn |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzl_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d1hnzl_: