![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50303] (14 PDB entries) |
![]() | Domain d1hr0l_: 1hr0 L: [25347] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ complexed with mg, zn |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOP Domain Sequences for d1hr0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d1hr0l_: