Lineage for d4kw6e_ (4kw6 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878092Species Ancylostoma ceylanicum [TaxId:53326] [197299] (2 PDB entries)
  8. 2878107Domain d4kw6e_: 4kw6 E: [253456]
    Other proteins in same PDB: d4kw6a2, d4kw6b2, d4kw6d2
    automated match to d4fh8a_
    complexed with qdo; mutant

Details for d4kw6e_

PDB Entry: 4kw6 (more details), 3 Å

PDB Description: Crystal structure of Peroxiredoxin-1 (C-terminal truncation mutant) from the human hookworm Ancylostoma ceylanicum bound to conoidin A
PDB Compounds: (E:) Peroxiredoxin-1

SCOPe Domain Sequences for d4kw6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kw6e_ c.47.1.10 (E:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]}
mskafigkpapdfatkavfdgdfvdvklsdykgkyvvlffypldftfvcpteiiafsdrf
pefknlnvavlacstdsvfshlawintprkhgglgdmkipvladtnhqiakdygvlkdde
giayrglfiidpkgilrqitindlpvgrsvdetlrlvqafqytdkhgevcp

SCOPe Domain Coordinates for d4kw6e_:

Click to download the PDB-style file with coordinates for d4kw6e_.
(The format of our PDB-style files is described here.)

Timeline for d4kw6e_: