SCOPe 2.06: Domain d4ku7a_: 4ku7 A:

Lineage for d4ku7a_ (4ku7 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256346] (13 PDB entries)

8. Domain d4ku7a_: 4ku7 A: [253445]
   automated match to d1u12b_
   complexed with iod, pcg

Details for d4ku7a_

PDB Entry: 4ku7, 1.65 Å

PDB Description: structures of pkgi reveal a cgmp-selective activation mechanism

PDB Compounds: (A:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d4ku7a_:

Sequence, based on SEQRES records:

>d4ku7a_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvn
vtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligg
lddvsnkay

Sequence, based on observed residues (ATOM records):

>d4ku7a_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvn
vtredpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligglddvs
nkay

Timeline for d4ku7a_:

• d4ku7a_ first appeared in SCOPe 2.04
  
• d4ku7a_ appears in SCOPe 2.05
  
• d4ku7a_ appears in SCOPe 2.07
  
• d4ku7a_ appears in the current release, SCOPe 2.08