Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (149 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d4kslj1: 4ksl J:0-76 [253420] automated match to d4auqc_ |
PDB Entry: 4ksl (more details), 2.83 Å
SCOPe Domain Sequences for d4kslj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kslj1 d.15.1.1 (J:0-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} gmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy niqkestlhlvlrlrgg
Timeline for d4kslj1: