SCOPe 2.06: Domain d4kroc2: 4kro C:108-211

Lineage for d4kroc2 (4kro C:108-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d4kroc2: 4kro C:108-211 [253411]
   automated match to d4m43l2
   complexed with nag

Details for d4kroc2

PDB Entry: 4kro, 3.05 Å

PDB Description: nanobody/vhh domain ega1 in complex with the extracellular region of egfr

PDB Compounds: (C:) Cetuximab light chain

SCOPe Domain Sequences for d4kroc2:

Sequence; same for both SEQRES and ATOM records:

>d4kroc2 b.1.1.0 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4kroc2:

• d4kroc2 first appeared in SCOPe 2.04
  
• d4kroc2 appears in SCOPe 2.05
  
• d4kroc2 appears in SCOPe 2.07
  
• d4kroc2 appears in the current release, SCOPe 2.08