Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein automated matches [190766] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries) |
Domain d4kodl3: 4kod L:201-459 [253401] Other proteins in same PDB: d4koda1, d4koda2, d4kodb1, d4kodb2, d4kodc1, d4kodc2, d4kodd1, d4kodd2, d4kode1, d4kode2, d4kodf1, d4kodf2, d4kodg1, d4kodg2, d4kodh1, d4kodh2, d4kodi1, d4kodi2, d4kodj1, d4kodj2, d4kodk1, d4kodk2, d4kodl1, d4kodl2 automated match to d1e32a2 complexed with adp; mutant |
PDB Entry: 4kod (more details), 2.96 Å
SCOPe Domain Sequences for d4kodl3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kodl3 c.37.1.20 (L:201-459) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae vmnslavtmddfrwalsqs
Timeline for d4kodl3:
View in 3D Domains from other chains: (mouse over for more information) d4koda1, d4koda2, d4koda3, d4kodb1, d4kodb2, d4kodb3, d4kodc1, d4kodc2, d4kodc3, d4kodd1, d4kodd2, d4kodd3, d4kode1, d4kode2, d4kode3, d4kodf1, d4kodf2, d4kodf3, d4kodg1, d4kodg2, d4kodg3, d4kodh1, d4kodh2, d4kodh3, d4kodi1, d4kodi2, d4kodi3, d4kodj1, d4kodj2, d4kodj3, d4kodk1, d4kodk2, d4kodk3 |