SCOPe 2.05: Domain d4kodh3: 4kod H:201-459

Lineage for d4kodh3 (4kod H:201-459)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein automated matches [190766] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries)

8. Domain d4kodh3: 4kod H:201-459 [253389]
   Other proteins in same PDB: d4koda1, d4koda2, d4kodb1, d4kodb2, d4kodc1, d4kodc2, d4kodd1, d4kodd2, d4kode1, d4kode2, d4kodf1, d4kodf2, d4kodg1, d4kodg2, d4kodh1, d4kodh2, d4kodi1, d4kodi2, d4kodj1, d4kodj2, d4kodk1, d4kodk2, d4kodl1, d4kodl2
   automated match to d1e32a2
   complexed with adp; mutant

Details for d4kodh3

PDB Entry: 4kod, 2.96 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ADP

PDB Compounds: (H:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4kodh3:

Sequence; same for both SEQRES and ATOM records:

>d4kodh3 c.37.1.20 (H:201-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqs

Timeline for d4kodh3:

• d4kodh3 first appeared in SCOPe 2.04
  
• d4kodh3 appears in SCOPe 2.06
  
• d4kodh3 appears in the current release, SCOPe 2.08