Lineage for d4kodh3 (4kod H:201-459)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597497Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1597800Protein automated matches [190766] (3 species)
    not a true protein
  7. 1597809Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries)
  8. 1597839Domain d4kodh3: 4kod H:201-459 [253389]
    Other proteins in same PDB: d4koda1, d4koda2, d4kodb1, d4kodb2, d4kodc1, d4kodc2, d4kodd1, d4kodd2, d4kode1, d4kode2, d4kodf1, d4kodf2, d4kodg1, d4kodg2, d4kodh1, d4kodh2, d4kodi1, d4kodi2, d4kodj1, d4kodj2, d4kodk1, d4kodk2, d4kodl1, d4kodl2
    automated match to d1e32a2
    complexed with adp; mutant

Details for d4kodh3

PDB Entry: 4kod (more details), 2.96 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ADP
PDB Compounds: (H:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4kodh3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kodh3 c.37.1.20 (H:201-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqs

SCOPe Domain Coordinates for d4kodh3:

Click to download the PDB-style file with coordinates for d4kodh3.
(The format of our PDB-style files is described here.)

Timeline for d4kodh3: