Lineage for d2a8vb_ (2a8v B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59561Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (10 proteins)
  6. 59590Protein Rho termination factor, N-terminal, RNA-binding domain [50294] (1 species)
  7. 59591Species Escherichia coli [TaxId:562] [50295] (4 PDB entries)
  8. 59596Domain d2a8vb_: 2a8v B: [25336]

Details for d2a8vb_

PDB Entry: 2a8v (more details), 2.4 Å

PDB Description: rho transcription termination factor/rna complex

SCOP Domain Sequences for d2a8vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8vb_ b.40.4.5 (B:) Rho termination factor, N-terminal, RNA-binding domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne

SCOP Domain Coordinates for d2a8vb_:

Click to download the PDB-style file with coordinates for d2a8vb_.
(The format of our PDB-style files is described here.)

Timeline for d2a8vb_: