Lineage for d1a8va_ (1a8v A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14165Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins)
  6. 14190Protein Rho termination factor, N-terminal, RNA-binding domain [50294] (1 species)
  7. 14191Species Escherichia coli [TaxId:562] [50295] (4 PDB entries)
  8. 14193Domain d1a8va_: 1a8v A: [25333]

Details for d1a8va_

PDB Entry: 1a8v (more details), 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator

SCOP Domain Sequences for d1a8va_:

Sequence, based on SEQRES records: (download)

>d1a8va_ b.40.4.5 (A:) Rho termination factor, N-terminal, RNA-binding domain {Escherichia coli}
ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleil
qdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne

Sequence, based on observed residues (ATOM records): (download)

>d1a8va_ b.40.4.5 (A:) Rho termination factor, N-terminal, RNA-binding domain {Escherichia coli}
ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleil
qdgfgflrsaagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvne

SCOP Domain Coordinates for d1a8va_:

Click to download the PDB-style file with coordinates for d1a8va_.
(The format of our PDB-style files is described here.)

Timeline for d1a8va_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a8vb_