Lineage for d1a62__ (1a62 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14165Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins)
  6. 14190Protein Rho termination factor, N-terminal, RNA-binding domain [50294] (1 species)
  7. 14191Species Escherichia coli [TaxId:562] [50295] (4 PDB entries)
  8. 14192Domain d1a62__: 1a62 - [25332]

Details for d1a62__

PDB Entry: 1a62 (more details), 1.55 Å

PDB Description: crystal structure of the rna-binding domain of the transcriptional terminator protein rho

SCOP Domain Sequences for d1a62__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a62__ b.40.4.5 (-) Rho termination factor, N-terminal, RNA-binding domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
fdkpe

SCOP Domain Coordinates for d1a62__:

Click to download the PDB-style file with coordinates for d1a62__.
(The format of our PDB-style files is described here.)

Timeline for d1a62__: