SCOPe 2.08: Domain d4kkcf2: 4kkc F:107-211

Lineage for d4kkcf2 (4kkc F:107-211)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d4kkcf2: 4kkc F:107-211 [253311]
Other proteins in same PDB: d4kkca_, d4kkcb_, d4kkcc_, d4kkcd1, d4kkce_, d4kkcf1
automated match to d1ikfl2
mutant

Details for d4kkcf2

PDB Entry: 4kkc (more details), 3.18 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 deltaNC construct in 20mM Bromide

PDB Compounds: (F:) Fab, light chain

SCOPe Domain Sequences for d4kkcf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkcf2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d4kkcf2:

Click to download the PDB-style file with coordinates for d4kkcf2.
(The format of our PDB-style files is described here.)

Timeline for d4kkcf2: