Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Translation initiation factor-1a, eIF1a [50292] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50293] (1 PDB entry) |
Domain d1d7qa_: 1d7q A: [25331] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1d7q (more details)
SCOPe Domain Sequences for d1d7qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7qa_ b.40.4.5 (A:) Translation initiation factor-1a, eIF1a {Human (Homo sapiens) [TaxId: 9606]} pknkgkggknrrrgknenesekrelvfkedgqeyaqvikmlgngrleamcfdgvkrlchi rgklrkkvwintsdiilvglrdyqdnkadvilkynadearslkaygelpehakinetdtf gpgdddeiqfddigdddediddi
Timeline for d1d7qa_: