Lineage for d4kkbf1 (4kkb F:1-106)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035415Domain d4kkbf1: 4kkb F:1-106 [253304]
    Other proteins in same PDB: d4kkba_, d4kkbb_, d4kkbd2, d4kkbf2
    automated match to d1ikfl1
    mutant

Details for d4kkbf1

PDB Entry: 4kkb (more details), 3.02 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 deltaNC construct in 20mM fluoride and 20mM Bromide
PDB Compounds: (F:) Fab, light chain

SCOPe Domain Sequences for d4kkbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkbf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d4kkbf1:

Click to download the PDB-style file with coordinates for d4kkbf1.
(The format of our PDB-style files is described here.)

Timeline for d4kkbf1: