Lineage for d4kkbd2 (4kkb D:107-211)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031325Domain d4kkbd2: 4kkb D:107-211 [253303]
    Other proteins in same PDB: d4kkba_, d4kkbb_, d4kkbd1, d4kkbf1
    automated match to d1ikfl2
    mutant

Details for d4kkbd2

PDB Entry: 4kkb (more details), 3.02 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 deltaNC construct in 20mM fluoride and 20mM Bromide
PDB Compounds: (D:) Fab, light chain

SCOPe Domain Sequences for d4kkbd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkbd2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d4kkbd2:

Click to download the PDB-style file with coordinates for d4kkbd2.
(The format of our PDB-style files is described here.)

Timeline for d4kkbd2: