Lineage for d1hr0w_ (1hr0 W:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59561Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (10 proteins)
  6. 59633Protein Translational initiation factor 1, IF1 [50290] (1 species)
  7. 59634Species Escherichia coli [TaxId:562] [50291] (2 PDB entries)
  8. 59635Domain d1hr0w_: 1hr0 W: [25329]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_

Details for d1hr0w_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0w_ b.40.4.5 (W:) Translational initiation factor 1, IF1 {Escherichia coli}
akekdtirtegvvtealpnatfrvkldsgpeilayisgkmrmhyirilpgdrvvveitpy
dptrgrivyrk

SCOP Domain Coordinates for d1hr0w_:

Click to download the PDB-style file with coordinates for d1hr0w_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0w_: