Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d4kk5f1: 4kk5 F:1-106 [253280] Other proteins in same PDB: d4kk5a_, d4kk5b_, d4kk5d2, d4kk5f2 automated match to d1ikfl1 |
PDB Entry: 4kk5 (more details), 3.17 Å
SCOPe Domain Sequences for d4kk5f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kk5f1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil
Timeline for d4kk5f1:
View in 3D Domains from other chains: (mouse over for more information) d4kk5a_, d4kk5b_, d4kk5d1, d4kk5d2 |