Class b: All beta proteins [48724] (149 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
Protein S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase [50287] (2 species) |
Species Escherichia coli [TaxId:562] [50288] (1 PDB entry) |
Domain d1sro__: 1sro - [25327] CASP2 |
PDB Entry: 1sro (more details)
SCOP Domain Sequences for d1sro__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sro__ b.40.4.5 (-) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli} aeievgrvytgkvtrivdfgafvaigggkeglvhisqiadkrvekvtdylqmgqevpvkv levdrqgrirlsikea
Timeline for d1sro__: