SCOP 1.71: Domain d1sro__: 1sro -

Lineage for d1sro__ (1sro -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase [50287] (2 species)

7. Species Escherichia coli [TaxId:562] [50288] (1 PDB entry)

8. Domain d1sro__: 1sro - [25327]
   CASP2

Details for d1sro__

PDB Entry: 1sro

PDB Description: s1 rna binding domain, nmr, 20 structures

SCOP Domain Sequences for d1sro__:

Sequence; same for both SEQRES and ATOM records:

>d1sro__ b.40.4.5 (-) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli}
aeievgrvytgkvtrivdfgafvaigggkeglvhisqiadkrvekvtdylqmgqevpvkv
levdrqgrirlsikea

Timeline for d1sro__:

• d1sro__ first appeared (with stable ids) in SCOP 1.55
  
• d1sro__ appears in SCOP 1.69
  
• d1sro__ is called d1sroa_ in SCOP 1.73
  
• d1sro__ appears in the current release, SCOPe 2.08, called d1sroa_