SCOPe 2.06: Domain d4kgga_: 4kgg A:

Lineage for d4kgga_ (4kgg A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)

8. Domain d4kgga_: 4kgg A: [253265]
   automated match to d4kg8b_
   complexed with mg; mutant

Details for d4kgga_

PDB Entry: 4kgg, 2.78 Å

PDB Description: crystal structure of light mutant2 and dcr3 complex

PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 14

SCOPe Domain Sequences for d4kgga_:

Sequence, based on SEQRES records:

>d4kgga_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcplglastithglykrtprypeelellvsqqspcgratssssnwfdssflggvvhlea
geevvvrvlderlvrlrdgtrsyfgafmv

Sequence, based on observed residues (ATOM records):

>d4kgga_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcplastithglykrtprypeelellvsqqspcgsnwfdssflggvvhleageevvvrv
lderlvrlrdgtrsyfgafmv

Timeline for d4kgga_:

• d4kgga_ first appeared in SCOPe 2.04
  
• d4kgga_ appears in SCOPe 2.05
  
• d4kgga_ appears in SCOPe 2.07
  
• d4kgga_ appears in the current release, SCOPe 2.08