SCOPe 2.07: Domain d4kgdb3: 4kgd B:366-593

Lineage for d4kgdb3 (4kgd B:366-593)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:644042] [256254] (3 PDB entries)

8. Domain d4kgdb3: 4kgd B:366-593 [253264]
   Other proteins in same PDB: d4kgda2, d4kgdb2
   automated match to d1powa3
   complexed with fad, gol, k, mg, po4, tdp

Details for d4kgdb3

PDB Entry: 4kgd, 1.06 Å

PDB Description: high-resolution crystal structure of pyruvate oxidase from l. plantarum in complex with phosphate

PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d4kgdb3:

Sequence; same for both SEQRES and ATOM records:

>d4kgdb3 c.36.1.0 (B:366-593) automated matches {Lactobacillus plantarum [TaxId: 644042]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

Timeline for d4kgdb3:

• d4kgdb3 first appeared in SCOPe 2.04
  
• d4kgdb3 appears in SCOPe 2.06
  
• d4kgdb3 appears in the current release, SCOPe 2.08