| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (14 species) not a true protein |
| Species Lactobacillus plantarum [TaxId:644042] [256255] (3 PDB entries) |
| Domain d4kgdb2: 4kgd B:183-365 [253263] Other proteins in same PDB: d4kgda1, d4kgda3, d4kgdb1, d4kgdb3 automated match to d1powa1 complexed with fad, gol, k, mg, po4, tdp |
PDB Entry: 4kgd (more details), 1.06 Å
SCOPe Domain Sequences for d4kgdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kgdb2 c.31.1.0 (B:183-365) automated matches {Lactobacillus plantarum [TaxId: 644042]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led
Timeline for d4kgdb2: