Lineage for d4kgda2 (4kgd A:183-365)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471274Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2471275Protein automated matches [190312] (14 species)
    not a true protein
  7. 2471348Species Lactobacillus plantarum [TaxId:644042] [256255] (3 PDB entries)
  8. 2471353Domain d4kgda2: 4kgd A:183-365 [253260]
    Other proteins in same PDB: d4kgda1, d4kgda3, d4kgdb1, d4kgdb3
    automated match to d1powa1
    complexed with fad, gol, k, mg, po4, tdp

Details for d4kgda2

PDB Entry: 4kgd (more details), 1.06 Å

PDB Description: high-resolution crystal structure of pyruvate oxidase from l. plantarum in complex with phosphate
PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d4kgda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kgda2 c.31.1.0 (A:183-365) automated matches {Lactobacillus plantarum [TaxId: 644042]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

SCOPe Domain Coordinates for d4kgda2:

Click to download the PDB-style file with coordinates for d4kgda2.
(The format of our PDB-style files is described here.)

Timeline for d4kgda2: