SCOPe 2.06: Domain d4kgda2: 4kgd A:183-365

Lineage for d4kgda2 (4kgd A:183-365)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (11 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:644042] [256255] (3 PDB entries)

8. Domain d4kgda2: 4kgd A:183-365 [253260]
   Other proteins in same PDB: d4kgda1, d4kgda3, d4kgdb1, d4kgdb3
   automated match to d1powa1
   complexed with fad, gol, k, mg, po4, tdp

Details for d4kgda2

PDB Entry: 4kgd, 1.06 Å

PDB Description: high-resolution crystal structure of pyruvate oxidase from l. plantarum in complex with phosphate

PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d4kgda2:

Sequence; same for both SEQRES and ATOM records:

>d4kgda2 c.31.1.0 (A:183-365) automated matches {Lactobacillus plantarum [TaxId: 644042]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

Timeline for d4kgda2:

• d4kgda2 first appeared in SCOPe 2.04
  
• d4kgda2 appears in SCOPe 2.05
  
• d4kgda2 appears in SCOPe 2.07
  
• d4kgda2 appears in the current release, SCOPe 2.08