SCOPe 2.04: Domain d4ke9c_: 4ke9 C:

Lineage for d4ke9c_ (4ke9 C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (56 species)
   not a true protein

7. Species Bacillus sp. [TaxId:129908] [256061] (7 PDB entries)

8. Domain d4ke9c_: 4ke9 C: [253248]
   automated match to d1r1da_
   complexed with 1r1

Details for d4ke9c_

PDB Entry: 4ke9, 2.2 Å

PDB Description: Crystal structure of Monoglyceride lipase from Bacillus sp. H257 in complex with an 1-stearyol glycerol analogue

PDB Compounds: (C:) Thermostable monoacylglycerol lipase

SCOPe Domain Sequences for d4ke9c_:

Sequence; same for both SEQRES and ATOM records:

>d4ke9c_ c.69.1.0 (C:) automated matches {Bacillus sp. [TaxId: 129908]}
qypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgthye
dmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpinaav
dipaiaagmtgggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldr
ivcpalifvsdedhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersle
ffakha

Timeline for d4ke9c_:

• d4ke9c_ is new in SCOPe 2.04-stable
  
• d4ke9c_ appears in SCOPe 2.05
  
• d4ke9c_ appears in the current release, SCOPe 2.08