Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (71 species) not a true protein |
Species Bacillus sp. [TaxId:129908] [256061] (7 PDB entries) |
Domain d4ke8d_: 4ke8 D: [253245] automated match to d1r1da_ complexed with 1qy |
PDB Entry: 4ke8 (more details), 1.85 Å
SCOPe Domain Sequences for d4ke8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ke8d_ c.69.1.0 (D:) automated matches {Bacillus sp. [TaxId: 129908]} seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina avdipaiaagmtgggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakl drivcpalifvsdedhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiers leffakhag
Timeline for d4ke8d_: