SCOPe 2.05: Domain d4ke6e_: 4ke6 E:

Lineage for d4ke6e_ (4ke6 E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Bacillus sp. [TaxId:129908] [256061] (7 PDB entries)

8. Domain d4ke6e_: 4ke6 E: [253238]
   automated match to d1r1da_
   complexed with 1qw, mpd; mutant

Details for d4ke6e_

PDB Entry: 4ke6, 2.8 Å

PDB Description: crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol

PDB Compounds: (E:) Thermostable monoacylglycerol lipase

SCOPe Domain Sequences for d4ke6e_:

Sequence, based on SEQRES records:

>d4ke6e_ c.69.1.0 (E:) automated matches {Bacillus sp. [TaxId: 129908]}
qypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgthye
dmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpinaav
dipaiaagmtgggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldr
ivcpalifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersle
ffakha

Sequence, based on observed residues (ATOM records):

>d4ke6e_ c.69.1.0 (E:) automated matches {Bacillus sp. [TaxId: 129908]}
qypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgthye
dmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpinaav
dipadlknpdvkelayektptasllqlarlmaqtkakldrivcpalifvsdenhvvppgn
adiifqgisstekeivrlrnsyhvatldydqpmiiersleffakha

Timeline for d4ke6e_:

• d4ke6e_ first appeared in SCOPe 2.04
  
• d4ke6e_ appears in SCOPe 2.06
  
• d4ke6e_ appears in the current release, SCOPe 2.08