Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (15 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [254984] (35 PDB entries) |
Domain d4k9ob1: 4k9o B:2-181 [253199] Other proteins in same PDB: d4k9oa2, d4k9ob2, d4k9oc2, d4k9od2 automated match to d2fwna2 complexed with ca, gol, mg, tpp; mutant |
PDB Entry: 4k9o (more details), 1.89 Å
SCOPe Domain Sequences for d4k9ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k9ob1 c.36.1.0 (B:2-181) automated matches {Pseudomonas putida [TaxId: 303]} asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
Timeline for d4k9ob1: