Lineage for d4k9nc1 (4k9n C:2-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865433Species Pseudomonas putida [TaxId:303] [254984] (38 PDB entries)
  8. 2865484Domain d4k9nc1: 4k9n C:2-181 [253190]
    Other proteins in same PDB: d4k9na2, d4k9nb2, d4k9nc2, d4k9nd2
    automated match to d2fwna2
    complexed with gol, mg, tzd; mutant

Details for d4k9nc1

PDB Entry: 4k9n (more details), 1.7 Å

PDB Description: Crystal Structure of the Ala460Ile mutant of Benzoylformate Decarboxylase from Pseudomonas putida
PDB Compounds: (C:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d4k9nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k9nc1 c.36.1.0 (C:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOPe Domain Coordinates for d4k9nc1:

Click to download the PDB-style file with coordinates for d4k9nc1.
(The format of our PDB-style files is described here.)

Timeline for d4k9nc1: