Lineage for d4k9el2 (4k9e L:111-216)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031260Domain d4k9el2: 4k9e L:111-216 [253174]
    Other proteins in same PDB: d4k9el1, d4k9el3
    automated match to d1um5l2
    complexed with nag

Details for d4k9el2

PDB Entry: 4k9e (more details), 2.7 Å

PDB Description: crystal structure of kit d4d5 fragment in complex with anti-kit antibodies fab79d
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d4k9el2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k9el2 b.1.1.2 (L:111-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4k9el2:

Click to download the PDB-style file with coordinates for d4k9el2.
(The format of our PDB-style files is described here.)

Timeline for d4k9el2: