Lineage for d4k9el1 (4k9e L:2-110)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767246Domain d4k9el1: 4k9e L:2-110 [253173]
    Other proteins in same PDB: d4k9el2
    automated match to d1um5l1
    complexed with nag

Details for d4k9el1

PDB Entry: 4k9e (more details), 2.7 Å

PDB Description: Crystal structure of KIT D4D5 fragment in complex with anti-Kit antibodies Fab79D
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d4k9el1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k9el1 b.1.1.0 (L:2-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspsslsasvgdrvtitcrasqrglrnvavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqwavhslitfgqgtkveik

SCOPe Domain Coordinates for d4k9el1:

Click to download the PDB-style file with coordinates for d4k9el1.
(The format of our PDB-style files is described here.)

Timeline for d4k9el1: