SCOP 1.67: Domain d1eujb_: 1euj B:

Lineage for d1eujb_ (1euj B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.4: Myf domain [50277] (6 proteins)

6. Protein EMAP II [50280] (1 species)
   domain of the p43 protein

7. Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)

8. Domain d1eujb_: 1euj B: [25317]

Details for d1eujb_

PDB Entry: 1euj, 1.8 Å

PDB Description: a novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases

SCOP Domain Sequences for d1eujb_:

Sequence; same for both SEQRES and ATOM records:

>d1eujb_ b.40.4.4 (B:) EMAP II {Human (Homo sapiens)}
pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik

Timeline for d1eujb_:

• d1eujb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eujb_ appears in SCOP 1.65
  
• d1eujb_ appears in SCOP 1.69
  
• d1eujb_ appears in the current release, SCOPe 2.08