Lineage for d1eujb_ (1euj B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110668Family b.40.4.4: Myf domain [50277] (3 proteins)
  6. 110682Protein EMAP II [50280] (1 species)
  7. 110683Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)
  8. 110686Domain d1eujb_: 1euj B: [25317]

Details for d1eujb_

PDB Entry: 1euj (more details), 1.8 Å

PDB Description: a novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases

SCOP Domain Sequences for d1eujb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eujb_ b.40.4.4 (B:) EMAP II {Human (Homo sapiens)}
pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik

SCOP Domain Coordinates for d1eujb_:

Click to download the PDB-style file with coordinates for d1eujb_.
(The format of our PDB-style files is described here.)

Timeline for d1eujb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1euja_