Lineage for d1eujb_ (1euj B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.4: Myf domain [50277] (2 proteins) Protein EMAP II [50280] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries) 
Domain d1eujb_: 1euj B: [25317]
Details for d1eujb_
PDB Entry: 1euj (more details), 1.8 Å
PDB Description: a novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases
SCOP Domain Sequences for d1eujb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eujb_ b.40.4.4 (B:) EMAP II {Human (Homo sapiens)}
pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik
SCOP Domain Coordinates for d1eujb_:
Click to download the PDB-style file with coordinates for d1eujb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eujb_:
- d1eujb_ appears in SCOP 1.57
- d1eujb_ appears in the current release, SCOPe 2.08
View in 3D
